- Recombinant Roseobacter denitrificans Light-harvesting protein B-870 beta chain (pufB)
- MyBioSource.com
- Pricing InfoSupplier PageView Company Product Page
- MBS1021198
- 1 mg (E Coli Derived)
- This item requires custom production and lead time is between 5-9 weeks. We can custom produce according to your specifications
- >90%
- Recombinant Protein
- 5,592 Da
- E Coli or Yeast
- Light-harvesting protein B-870 beta chain (pufB)
- 18295
Sequence
ADNTDLSFTGLTDEQAQELHSVYMSGLFLFAAVAVVAHLATYIWRPWFG